Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using Tyrosine Hydroxylase Rabbit pAb (A12756) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat adrenal gland using Tyrosine Hydroxylase Rabbit pAb (A12756) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of SH-SY5Y cells using Tyrosine Hydroxylase Rabbit pAb(A12756) at a dilution of 1:150 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Tyrosine Hydroxylase Rabbit pAb(A12756) at a dilution of 1:150 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Tyrosine Hydroxylase Rabbit pAb |
|---|---|
| Catalog No. | A12756 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2). |
|---|---|
| Sequence | KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TYH; DYT14; DYT5b; Tyrosine Hydroxylase |
| Calculated MW | 59kDa |
| Observed MW |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse brain, Rat brain |
| Cellular location | axon, cytoplasm, cytoplasmic side of plasma membrane, cytoplasmic vesicle, cytosol, dendrite, mitochondrion, neuron projection, nucleus, perikaryon, perinuclear region of cytoplasm, smooth endoplasmic reticulum, synaptic vesicle, terminal bouton |
| Customer validation | IHC(Mus musculus, Rattus norvegicus) WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Other, Canis familiaris, Oryctolagus cuniculus) IHC(Rattus norvegicus) IHC(Oryctolagus cuniculus) WB(Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12756? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1718356414)
