Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Ubiquitin Rabbit pAb |
---|---|
Catalog No. | A0162 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human Ubiquitin (NP_061828.1). |
---|---|
Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |
Gene ID | |
Swiss Prot | |
Synonyms | HEL-S-50; Ubiquitin |
Calculated MW | 26kDa |
Observed MW | >10kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa treated by MG132, C6 treated by MG132, NIH/3T3 treated by MG132 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Homo sapiens, Crassostrea gigas, Mus musculus , Triticum aestivum, Zea mays, Bos taurus) IF(Brachyura, Homo sapiens) Co-IP(Homo sapiens, Other) Co-IP(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) IP(Homo sapiens) WB(Other, Homo sapiens, Mus musculus) IHC(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0162? Please let us know so that we can cite the reference in this datasheet.