Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | VCAM1 Rabbit pAb |
---|---|
Catalog No. | A0279 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1). |
---|---|
Sequence | NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL |
Gene ID | |
Swiss Prot | |
Synonyms | CD106; INCAM-100; VCAM1 |
Calculated MW | 81kDa |
Observed MW | 95-120kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HUVEC treated by hTNF-α, Mouse liver |
Cellular location | Membrane, Single-pass type I membrane protein. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Cynoglossus semilaevis) IHC(Mus musculus) IF(Mus musculus, Rattus norvegicus) WB(Mus musculus,Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0279? Please let us know so that we can cite the reference in this datasheet.