Review (1)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | VE Cadherin Rabbit pAb |
---|---|
Catalog No. | A0734 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human VE Cadherin (NP_001786.2). |
---|---|
Sequence | TQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQ |
Gene ID | |
Swiss Prot | |
Synonyms | 7B4; CD144; VE Cadherin |
Calculated MW | 88kDa |
Observed MW | 130kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HUVEC, Mouse brain |
Cellular location | Cell junction, Cell membrane, Single-pass type I membrane protein. |
Customer validation | (HUVEC) WB(Bos taurus , Mus musculus, Homo sapiens, Sus scrofa, Xenopus laevis, Rattus norvegicus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0734? Please let us know so that we can cite the reference in this datasheet.