Reviews (2)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | VEGFA Rabbit pAb |
---|---|
Catalog No. | A5708 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-147 of human VEGFA (NP_001165099.1). |
---|---|
Sequence | SYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR |
Gene ID | |
Swiss Prot | |
Synonyms | VPF; VEGF; MVCD1; VEGFA |
Calculated MW | 27kDa |
Observed MW | 17kDa/22kDa/27kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, HeLa, Mouse brain, Mouse kidney, Rat lung |
Cellular location | Secreted. |
Customer validation | (HUVEC cells, H460) WB(Homo sapiens, Gallus gallus, Mus musculus, Rattus norvegicus, Mus musculus) IHC(Gallus gallus) IF(Gallus gallus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5708? Please let us know so that we can cite the reference in this datasheet.