Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse liver using VEGFR3/FLT4 Rabbit pAb(A5605) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime:60s.
Immunohistochemistry analysis of VEGFR3/FLT4 in paraffin-embedded human liver tissue using VEGFR3/FLT4 Rabbit pAb (A5605) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of VEGFR3/FLT4 in paraffin-embedded mouse colon tissue using VEGFR3/FLT4 Rabbit pAb (A5605) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of VEGFR3/FLT4 in paraffin-embedded rat colon tissue using VEGFR3/FLT4 Rabbit pAb (A5605) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | VEGFR3/FLT4 Rabbit pAb |
|---|---|
| Catalog No. | A5605 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 330-553 of human VEGFR3/FLT4 (NP_002011.2). |
|---|---|
| Sequence | LPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PCL; CHTD7; FLT-4; FLT41; LMPH1A; LMPHM1; VEGFR3; VEGFR-3 |
| Calculated MW | 153kDa |
| Observed MW | 150kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse liver |
| Cellular location | Cell membrane, Cytoplasm, Nucleus, Secreted, Single-pass type I membrane protein |
| Customer validation | IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5605? Please let us know so that we can cite the reference in this datasheet.
