제품 > 항체 > 단일클론항체(mAb)

WDR5 Rabbit mAb (A3259)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of various cell lines, using WDR5 Rabbit mAb (A3259) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	WDR5 Rabbit mAb
Catalog No.	A3259
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0769

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1).
Sequence	DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Gene ID
Swiss Prot
Synonyms	BIG3; SWD3; BIG-3; CFAP89
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A549, HT-1080, Rat testis
Cellular location	Nucleus
Customer validation	(minami-45、PC-3、Ramos) ChIP(Homo sapiens) WB(Oryctolagus cuniculus, Mus musculus)