제품 > 항체 > 단일클론항체(mAb)

eIF2C3 Rabbit mAb (A19819)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using eIF2C3 Rabbit mAb (A19819) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - eIF2C3 Rabbit mAb (A19819)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using eIF2C3 Rabbit mAb (A19819) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	eIF2C3 Rabbit mAb
Catalog No.	A19819
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2345

Background

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7).
Sequence	RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA
Gene ID
Swiss Prot
Synonyms	EIF2C3; Argonaute3; hAgo3; eIF2C3
Calculated MW	97kDa
Observed MW	97kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, C2C12, U-87MG, Mouse lung, Mouse brain, Rat lung
Cellular location	Condensed nuclear chromosome, Cytoplasm, Cytoplasmic ribonucleoprotein granule, Cytosol, Nucleoplasm, P-body
Customer validation	ELISA(Homo sapiens)