Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from 293T cells, using eNOS Rabbit pAb (A15075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of lysates from Mouse liver, using eNOS Rabbit pAb (A15075) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat brain using eNOS Rabbit pAb (A15075) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Product name | eNOS Rabbit pAb |
|---|---|
| Catalog No. | A15075 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 639-738 of human eNOS (NP_000594.2). |
|---|---|
| Sequence | AGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | eNOS; ECNOS |
| Calculated MW | 133kDa |
| Observed MW | 140kDa/160kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293T, Mouse liver |
| Cellular location | Cell membrane, Cytoplasm, Golgi apparatus, Membrane, caveola, cytoskeleton |
| Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15075? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1714983404 "ABclonal:Western blot - eNOS Rabbit pAb (A15075)")
_IHC_01.jpg?t=1714983404 "ABclonal:Immunohistochemistry - eNOS Rabbit pAb (A15075)")
