제품 > 항체 > 단일클론항체(mAb)

hCG Beta Rabbit mAb (A24128)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using hCG Beta Rabbit mAb (A24128) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): THP-1
Exposure time: 45s.

ABclonal:Immunohistochemistry - hCG Beta Rabbit mAb (A24128)

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using hCG Beta Rabbit mAb (A24128) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	hCG Beta Rabbit mAb
Catalog No.	A24128
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64338

Background

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-165 of human hCG Beta1 (NP_000728.1).
Sequence	SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Gene ID
Swiss Prot
Synonyms	CGB; LHB; CGB5; CGB7; CGB8; hCGB; hCG Beta
Calculated MW	18kDa
Observed MW	23kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	BeWo
Cellular location	Secreted.