Reviews (3)Publications (17) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | p38 MAPK Rabbit pAb |
---|---|
Catalog No. | A0227 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 261-360 of human p38 MAPK (NP_620581.1). |
---|---|
Sequence | SLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Gene ID | |
Swiss Prot | |
Synonyms | RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA; p38 MAPK |
Calculated MW | 41kDa |
Observed MW | 38kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, Jurkat, BxPC-3, RD, U-87MG, LO2, NIH/3T3, Mouse liver, Mouse kidney, Mouse thymus, Mouse brain, Mouse pancreas, Mouse testis, Rat kidney, Rat skeletal muscle |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (Raw264.7, HepG2, Mouse) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Danio rerio, Gallus gallus, Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0227? Please let us know so that we can cite the reference in this datasheet.