Reviews (3)Publications (22) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | p53 Rabbit pAb |
---|---|
Catalog No. | A5761 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 218-390 of human p53 (NP_035770.2). |
---|---|
Sequence | EPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD |
Gene ID | |
Swiss Prot | |
Synonyms | P53; BCC7; LFS1; BMFS5; TRP53; p53 |
Calculated MW | 44kDa |
Observed MW | 53kDa/ |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | U-251MG, 293T |
Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body. |
Customer validation | (Hepatoma cell line, Rat cells, MEF) WB(Homo sapiens, Rattus norvegicus, Lampetra japonica, Mus musculus, Mus musculus, ovis aries) IF(Lampetra japonica, Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5761? Please let us know so that we can cite the reference in this datasheet.