제품 > 항체 > 다중클론항체(pAb)

p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718)

Immunofluorescence analysis of L929 cells using p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using p90Rsk/RSK1/RPS6KA1 Rabbit pAb (A15718) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	p90Rsk/RSK1/RPS6KA1 Rabbit pAb
Catalog No.	A15718
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human p90Rsk/RSK1/RPS6KA1 (NP_002944.2).
Sequence	LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Gene ID
Swiss Prot
Synonyms	RSK; HU-1; RSK1; p90Rsk; MAPKAPK1; MAPKAPK1A; p90Rsk/RSK1/RPS6KA1
Calculated MW	83kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HT-29, HeLa, MCF7, K-562, Mouse lung, Mouse brain
Cellular location	Cytoplasm, Nucleus
Customer validation	IF(Mus musculus) WB(Sus scrofa, Rattus norvegicus, Mus musculus) IP(Mus musculus)