Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | p90Rsk/RSK1/RPS6KA1 Rabbit pAb |
---|---|
Catalog No. | A15718 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human p90Rsk/RSK1/RPS6KA1 (NP_002944.2). |
---|---|
Sequence | LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL |
Gene ID | |
Swiss Prot | |
Synonyms | RSK; HU-1; RSK1; p90Rsk; MAPKAPK1; MAPKAPK1A; p90Rsk/RSK1/RPS6KA1 |
Calculated MW | 83kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HT-29, HeLa, MCF7, K-562, Mouse lung, Mouse brain |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IF(Mus musculus) WB(Sus scrofa, Rattus norvegicus, Mus musculus) IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15718? Please let us know so that we can cite the reference in this datasheet.