제품 > 항체 > 다중클론항체(pAb)

pan-Trk Rabbit pAb (A22121)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse brain, using pan-Trk Rabbit pAb (A22121) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	pan-Trk Rabbit pAb
Catalog No.	A22121
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Neurotrophic tyrosine kinase (NTRK) is a family of receptor tyrosine kinase.The NTRK gene family contains three members, NTRK1, NTRK2 and NTRK3, which produce TRKA, TRKB and TRKC proteins, respectively.TRK kinases leads to cell differentiation and may play important roles in normal neural functions.Rearrangements in the NTRK genes can result in two genes fusing together and producing altered TRK proteins, which can lead to uncontrolled growth of cancer cells. Neurotrophic tyrosine receptor kinase (NTRK) gene fusions are an actionable biomarker for cancer therapy and can be found in over 25 different types of cancer.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 697-796 of human pan-Trk (NP_002520.2).
Sequence	ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Gene ID
Swiss Prot
Synonyms
Calculated MW
Observed MW	120-140kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain
Cellular location	axon, dendrite, early endosome, late endosome, plasma membrane.