Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | ABflo® 488 anti-Mouse CD80 mAb |
---|---|
Catalog No. | A26801 |
Host species | Armenian Hamster |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ACC0012-ABflo488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 38-245 of Mouse CD80. |
---|---|
Sequence | VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK |
Gene ID | |
Swiss Prot | |
Synonyms | B71; Ly53; TSA1; Cd28l; Ly-53; MIC17 |
Calculated MW | 34kDa |
Observed MW |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Membrane, Single-pass type I membrane protein. |
* For research use only. Not for therapeutic or diagnostic purposes.