Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Widely Range, Oryza sativa, Arabidopsis thaliana
Product name | Actin(Plant Specific) Rabbit mAb |
---|---|
Catalog No. | A23959 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62861 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of Actin(Plant Specific)(NP_190236.1). |
---|---|
Sequence | MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP |
Gene ID | |
Swiss Prot | |
Synonyms | ACT12; Actin(Plant Specific) |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Widely Range, Oryza sativa, Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Oryza sativa, Arabidopsis thaliana |
Cellular location | Cytoplasm, Cytoskeleton. |
Customer validation | WB(Arabidopsis thaliana) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23959? Please let us know so that we can cite the reference in this datasheet.