Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Species independent
Product name | HRP-conjugated Mouse anti GST-Tag mAb |
---|---|
Catalog No. | AE027 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | igg2b, Kappa |
CloneNo. | AMC0513 |
Immunogen | Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein. |
---|---|
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK |
Gene ID | |
Swiss Prot | |
Synonyms | GST; GST tag; GST-tag |
Calculated MW | 26kDa |
Observed MW | 27kDa |
Reactivity | Species independent |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Recombinant GST Protein |
Cellular location | |
Customer validation | WB(Homo sapiens, Escherichia coli, Glycine max) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using AE027? Please let us know so that we can cite the reference in this datasheet.