Overview
Product name | Magnetic Beads-conjugated Mouse anti GFP-Tag mAb |
---|
Catalog No. | AE168 |
---|
Host species | Mouse |
---|
Purification method | Affinity purification |
---|
Isotype | IgG1 |
---|
CloneNo. | AMC0483R-Beads |
---|
Background
The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm. GFP makes for an excellent tool in many forms of biology due to its ability to form internal chromophore without requiring any accessory cofactors, gene products, or enzymes / substrates other than molecular oxygen.In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. It has been used in modified forms to make biosensors, and many animals have been created that express GFP, which demonstrates a proof of concept that a gene can be expressed throughout a given organism, in selected organs, or in cells of interest. GFP can be introduced into animals or other species through transgenic techniques, and maintained in their genome and that of their offspring. To date, GFP has been expressed in many species, including bacteria, yeasts, fungi, fish and mammals, including in human cells.
Immunogen information
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 to the N-terminus of GFP protein. |
---|
Sequence | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF |
---|
Gene ID | |
---|
Swiss Prot | |
---|
Synonyms | GFP; GFP tag; GFP-tag |
---|
Calculated MW | 27kDa |
---|
Observed MW | Refer to figures |
---|
Applications
Documents
Certificate of Compliance
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Research Area
Magnetic Beads-conjugated Mouse anti GFP-Tag mAb images
Immunoprecipitation - Magnetic Beads-conjugated Mouse anti GFP-Tag mAb (AE168)
Immunoprecipitation analysis of 300ug extracts of 293T-SERPINB1-Flag-GFP-N cells using 30ul Magnetic Beads-conjugated Mouse anti GFP-Tag mAb (AE168). Western blot was performed from the immunoprecipitate using Magnetic Beads-conjugated Mouse anti GFP-Tag mAb (AE168) at a dilition of 1:2000.
* For research use only. Not for therapeutic or diagnostic purposes.