Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Species independent
Product name | Mouse anti mCherry-Tag mAb |
---|---|
Catalog No. | AE002 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG1 |
CloneNo. | AMC0502 |
Immunogen | Recombinant protein of mCherry tag |
---|---|
Sequence | MLSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
Gene ID | |
Swiss Prot | |
Synonyms | mCherry; mCherry tag; mCherry-tag |
Calculated MW | |
Observed MW | 55kDa |
Reactivity | Species independent |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 1% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T-CT55-mcherry |
Cellular location | |
Customer validation | WB(Homo sapiens, Danio rerio, Mus musculus, Cryptobranchidae, Felis catus, Other, Nicotiana benthamiana, Glycine max, Takifugu rubripes, Arabidopsis thaliana, Chlorocebus aethiops, Drosophila melanogaster) IF(Mus musculus, Homo sapiens, Mus musculus, Danio rerio, Other) IP(Homo sapiens) IF(Mus musculus, Homo sapiens, Chlorocebus aethiops) Injection(Mus musculus) IP(Homo sapiens, Chlorocebus aethiops) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using AE002? Please let us know so that we can cite the reference in this datasheet.