Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Species independent
Product name | Rabbit anti GST-Tag mAb |
---|---|
Catalog No. | AE077 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50738 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of schja GST protein (P08515). |
---|---|
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK |
Gene ID | |
Swiss Prot | |
Synonyms | GST; GST tag; GST-tag |
Calculated MW | 26kDa |
Observed MW | 27kDa/33.9kDa |
Reactivity | Species independent |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | GST protein |
Cellular location | |
Customer validation | WB(Arabidopsis thaliana, Oryza sativa, Homo sapiens, Mus musculus, Zea mays, Escherichia coli) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using AE077? Please let us know so that we can cite the reference in this datasheet.