Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Phospho-SRC Family-Y416 Antibody kit |
---|---|
Catalog No. | RK06002 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-SRC Family-Y416 Rabbit pAb | AP0480 | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition | Human, Mouse, Rat |
Src Rabbit pAb | A18240 | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 430-530 of human Src (NP_005408.1). A synthetic phosphorylated peptide around Y416 of human SRC Family (NP_005408.1). |
---|---|
Sequence | KWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY EDNEY |
Gene ID | 2534/3055/3932/4067/6714/7525 |
Swiss prot | P06241/P08631/P06239/P07948/P12931/P07947 |
Synonyms | ASV; SRC1; THC6; c-SRC; p60-Src; SRC; Phospho-SRC Family-Y416 |
Calculated MW | 59kDa/60kDa |
---|---|
Observed MW | 60kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Cellular location | Cell membrane,Cytoplasm,Mitochondrion inner membrane,Nucleus,cytoskeleton. |
Western blot analysis of lysates from NIH/3T3 cells, using Phospho-SRC Family-Y416 Rabbit pAb (AP0480). NIH/3T3 cells were treated by pervanadate.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Western blot analysis of lysates from NIH/3T3 cells, using Phospho-SRC Family-Y416 Rabbit pAb ( A18240). NIH/3T3 cells were treated by PDGF (100 ng/mL) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates using Src pAb (A18240) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Publishing research using RK06002? Please let us know so that we can cite the reference in this datasheet.
!OUT OF STOCK
See Below for Alternatives