제품 > 항체 > 단일클론항체(mAb)

Ripk3 Mouse mAb (A27121)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Ripk3 Mouse mAb (A27121) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunohistochemistry - Ripk3 Mouse mAb (A27121)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Ripk3 Mouse mAb (A27121) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Ripk3 Mouse mAb (A27121) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Ripk3 Mouse mAb (A27121) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	Ripk3 Mouse mAb
Catalog No.	A27121
Host species	Mouse
Purification method	Affinity purification
Isotype	IgG1 κ
CloneNo.	AMC0707

Background

The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of human RIP3 (NP_006862.2).
Sequence	SLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKAST
Gene ID
Swiss Prot
Synonyms	RIP3; RIPK3
Calculated MW	57kDa
Observed MW	60kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at 4℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% Sodium azide, pH7.2.
Key application	Western blotting Immunohistochemistry
Positive samples	NIH/3T3, RAW 264.7, C6
Cellular location	Cell membrane, Cytoplasm, cytosol.