Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:
Dose response curve of HRP conjugated Rabbit Anti-Mouse IgD (Fc) mAb measured by ELISA. 1 µg/mL of various immunoglobulins were coated to 384-well plate., blank wells without protein were used as negative control (NC). The coated plate was blocked and subsequently incubated with 25 µL of HRP conjugated Rabbit Anti-Mouse IgD (Fc) mAb in a 2 fold serial dilution from 2 μg/mL to 6.1*10^-5 pg/mL, incubation was performed at room temperature for 1 hour. The ELISA result demonstrated that Rabbit Rabbit Anti-Mouse IgD (Fc) has highly specific recognition of Mouse IgD while no or minimal cross reactivity to Mouse IgG1、Mouse IgG2a、Mouse IgG2b、Mouse IgG2c、Mouse IgG3、Mouse IgM、Mouse IgE、Mouse IgA、Rat IgG、Human IgG.
| Product name | HRP conjugated Rabbit Anti-Mouse IgD (Fc) mAb |
|---|---|
| Catalog No. | AS124 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-257 of Mouse IgD (P01881). |
|---|---|
| Sequence | DKKEPDMFLLSECKAPEENEKINLGCLVIGSQPLKISWEPKKSSIVEHVFPSEMRNGNYTMVLQVTVLASELNLNHTCTINKPKRKEKPFKFPESWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIEGAMAPSNLTVNILTTSTHPEMSSWLLCEVSGFFPENIHLMWLGVHSKMKSTNFVTANPTAQPGGTFQTWSVLRLPVALSSSLDTYTCVVEHEASKTKLNASKSLAISGCYHLLPESDGPSRRPDGPALA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | IgD; Igh-5 |
| Calculated MW | 28kDa |
| Observed MW | Refer to figures |
| Reactivity | |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | |
| Positive samples | |
| Cellular location | Secreted. |
* For research use only. Not for therapeutic or diagnostic purposes.
