Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 488 Rabbit anti-Human CD337/NKp30 mAb |
---|---|
Catalog No. | A23735 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC60018-ABflo488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1). |
---|---|
Sequence | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG |
Gene ID | |
Swiss Prot | |
Synonyms | NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3 |
Calculated MW | 16kDa/17kDa/18kDa/19kDa/20kDa/21kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Immunofluorescence |
Positive samples | |
Cellular location | Plasma membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.