제품 > 항체 > 단일클론항체(mAb)

NCR3 Rabbit mAb (A24295)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from control 293T and NCR3-293T trasfected cells, using NCR3 Rabbit mAb (A24295) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - NCR3 Rabbit mAb (A24295)

Confocal imaging of 293F-CD337 and 293F cells using NCR3 Rabbit mAb (A24295, at dilution of 1:200) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Flow CytoMetry - NCR3 Rabbit mAb (A24295)

Flow cytometry: 1X10^6 293T cells (Low Expression, left) and 293T(Transfection, right) cells were intracellularly-stained with NCR3 Rabbit mAb(A24295, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or NCR3 Rabbit mAb(A24295, 2 μg/mL, right).

Overview

Product name	NCR3 Rabbit mAb
Catalog No.	A24295
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60018

Background

The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1).
Sequence	LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Gene ID
Swiss Prot
Synonyms	NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3
Calculated MW	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Observed MW	30kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:200 - 1:800 FC (intra) 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T transfected with NCR3 (Human)
Cellular location	Plasma membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NCR3 Rabbit mAb images

Western blot - NCR3 Rabbit mAb (A24295)

Immunofluorescence - NCR3 Rabbit mAb (A24295)

Confocal imaging of 293F-CD337 and 293F cells using NCR3 Rabbit mAb (A24295, at dilution of 1:200) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Flow CytoMetry - NCR3 Rabbit mAb (A24295)

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or NCR3 Rabbit mAb(A24295, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.