제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb (A23737)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of 293T cells transfected with CD337/NKp30 using ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb (A23737, dilution 1:100) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb (A23737)

Flow cytometry: 1X10^6 293T cells(Low Expression, left) and 293T(Transfection, right) cells were intracellularly-stained with ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb(A23737, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb(A23737, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb
Catalog No.	A23737
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60018-ABf594

Background

The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1).
Sequence	LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Gene ID
Swiss Prot
Synonyms	NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3
Calculated MW	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Plasma membrane.