제품 > 항체 > 단일클론항체(mAb)

PE/Cyanine7 Rabbit anti-Human IFN-gamma mAb (A27517)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were intracellularly-stained with PE/Cyanine7 Rabbit anti-Human IFN-gamma mAb (A27517, 5 μl/Test, orange line) or PE/Cyanine7 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were intracellularly-stained with PE/Cyanine7 Rabbit IgG isotype control (5 μl/Test, left) or PE/Cyanine7 Rabbit anti-Human IFN-gamma mAb (A27517, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC (untreated, left) andHuman PBMC (treated with 50 ng/mL PMA and 1 ug/mL Ionomycin for 4-6 hours in the presence of monensin, right) were intracellularly-stained with PE/Cyanine7 Rabbit anti-Human IFN-gamma mAb (A27517, 5 μl/Test, orange line) or PE/Cyanine7 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	PE/Cyanine7 Rabbit anti-Human IFN-gamma mAb
Catalog No.	A27517
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67550-PE-Cy7

Background

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-166 of human IFN-gamma (NP_000610.2).
Sequence	QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Gene ID
Swiss Prot
Synonyms	IFG; IFI; IMD69
Calculated MW	19kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted.