제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human IFN-gamma mAb (A25558)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were intracellularly-stained with ABflo® 647 Rabbit anti-Human IFN-gamma mAb (A25558, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human IFN-gamma mAb (A25558, 5 μl/Test, right).

Flow cytometry: 1X10^6 PBMC (negative control, left) and PBMC (treated with TPA+Ionomycin+Brefeldin A, right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human IFN-gamma mAb (A25558, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 PBMC (treated with TPA+Ionomycin+Brefeldin A) were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human IFN-gamma mAb (A25558, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 647 Rabbit anti-Human IFN-gamma mAb
Catalog No.	A25558
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67550-ABflo647

Background

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-166 of human IFN-gamma (NP_000610.2).
Sequence	QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Gene ID
Swiss Prot
Synonyms	IFG; IFI; IMD69
Calculated MW	19kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted
Customer validation	(Human PBMCs)