Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Monkey
Product name | ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb |
---|---|
Catalog No. | A22153 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51683-ABflo647 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2). |
---|---|
Sequence | LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF |
Gene ID | |
Swiss Prot | |
Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 |
Calculated MW | 14kDa/33kDa |
Observed MW | Refer to figures |
Reactivity | Human, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, Multi-pass membrane protein, Lipid-anchor. |
Customer validation | (Human PBMCs) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr