제품 > 항체 > 단일클론항체(mAb)

CD20 Rabbit mAb (A4893)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Western blot analysis of various lysates, using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa
Exposure time: 60s.

ABclonal:Immunohistochemistry - CD20 Rabbit mAb (A4893)

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD20 Rabbit mAb (A4893) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using CD20 Rabbit mAb (A4893) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD20 Rabbit mAb (A4893)

Confocal imaging of Daudi and Jurkat(Negative control) cells using CD20 Rabbit mAb (A4893, dilution 1:1000)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD20 Rabbit mAb (A4893)

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with CD20 Rabbit mAb (A4893, 10 μg/mL orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 10 μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line).

Review

Overview

Product name	CD20 Rabbit mAb
Catalog No.	A4893
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51683

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).
Sequence	LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID
Swiss Prot
Synonyms	B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW	33kDa
Observed MW	30-50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:2000 - 1:10000 IF/ICC 1:800 - 1:3200 FC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	A-549, Raji, U-937
Cellular location	Cell membrane, Lipid-anchor, Multi-pass membrane protein.
Customer validation	(Homo sapiens, Data source:fynnbio) IHC(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD20 Rabbit mAb images

Western blot - CD20 Rabbit mAb (A4893)

Immunohistochemistry - CD20 Rabbit mAb (A4893)

Immunofluorescence - CD20 Rabbit mAb (A4893)

Confocal imaging of Daudi and Jurkat(Negative control) cells using CD20 Rabbit mAb (A4893, dilution 1:1000)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Flow CytoMetry - CD20 Rabbit mAb (A4893)

* For research use only. Not for therapeutic or diagnostic purposes.