Review (1)Publications (6) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Western blot analysis of various lysates, using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD20 Rabbit mAb (A4893) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using CD20 Rabbit mAb (A4893) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of Daudi and Jurkat(Negative control) cells using CD20 Rabbit mAb (A4893, dilution 1:1000)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.
Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with CD20 Rabbit mAb (A4893, 10 μg/mL orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 10 μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line).
| Product name | CD20 Rabbit mAb |
|---|---|
| Catalog No. | A4893 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC51683 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2). |
|---|---|
| Sequence | LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF |
| Gene ID | |
| Swiss Prot | |
| Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 |
| Calculated MW | 33kDa |
| Observed MW | 30-50kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry |
| Positive samples | A-549, Raji, U-937 |
| Cellular location | Cell membrane, Lipid-anchor, Multi-pass membrane protein. |
| Customer validation | (Homo sapiens, Data source:fynnbio) IHC(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A4893? Please let us know so that we can cite the reference in this datasheet.
