APC Rabbit anti-Human/Monkey CD20 mAb (A27309)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Monkey

ABclonal:Flow CytoMetry - APC Rabbit anti-Human/Monkey CD20 mAb (A27309)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human/Monkey CD20 mAb (A27309, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Human/Monkey CD20 mAb
Catalog No.	A27309
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51683-APC

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).
Sequence	LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID
Swiss Prot
Synonyms	B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW	14kDa/33kDa
Observed MW

Applications

Reactivity	Human, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein, Lipid-anchor.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Human/Monkey CD20 mAb images

Flow CytoMetry - APC Rabbit anti-Human/Monkey CD20 mAb (A27309)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human/Monkey CD20 mAb (A27309, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.