제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human/Monkey CD20 mAb (A24420)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with PE Rabbit anti-Human/Monkey CD20 mAb(A24420, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human/Monkey CD20 mAb(A24420, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human/Monkey CD20 mAb
Catalog No.	A24420
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51683-PE

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).
Sequence	LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID
Swiss Prot
Synonyms	MS4A1; B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7; B-lymphocyte antigen CD20
Calculated MW	14kDa/33kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein, Lipid-anchor

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human/Monkey CD20 mAb images

Flow CytoMetry - PE Rabbit anti-Human/Monkey CD20 mAb (A24420)

Flow cytometry:1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human/Monkey CD20 mAb(A24420, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.