제품 > 항체 > 다중클론항체(pAb)

FOS Rabbit pAb (A17351)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FOS Rabbit pAb (A17351) at 1:1000 dilution. NIH/3T3 cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	FOS Rabbit pAb
Catalog No.	A17351
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOS (NP_005243.1).
Sequence	MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
Gene ID
Swiss Prot
Synonyms	p55; AP-1; C-FOS; FOS
Calculated MW	41kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, NIH/3T3 treated by PMA, Rat brain, Rat liver
Cellular location	Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol.
Customer validation	WB(Rattus norvegicus, Homo sapiens)