Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FOS Rabbit pAb |
---|---|
Catalog No. | A17351 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOS (NP_005243.1). |
---|---|
Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA |
Gene ID | |
Swiss Prot | |
Synonyms | p55; AP-1; C-FOS; FOS |
Calculated MW | 41kDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, NIH/3T3 treated by PMA, Rat brain, Rat liver |
Cellular location | Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol. |
Customer validation | WB(Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17351? Please let us know so that we can cite the reference in this datasheet.