Reviews (3)Publications (31) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CDK4 Rabbit pAb |
---|---|
Catalog No. | A0366 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-303 of human CDK4 (NP_000066.1). |
---|---|
Sequence | VGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Gene ID | |
Swiss Prot | |
Synonyms | CMM3; PSK-J3; CDK4 |
Calculated MW | 34kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | 293T, HeLa, Mouse thymus, Mouse kidney |
Cellular location | Cytoplasm, Membrane, Nucleus. |
Customer validation | (H460,A549, Human lung cancer, Non-small-cell carcinoma) IHC(Homo sapiens, Mus musculus) WB(Mus musculus, Homo sapiens, Sus scrofa, Capra hircus, Other) IHC(Homo sapiens) IF(Homo sapiens, Other) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0366? Please let us know so that we can cite the reference in this datasheet.