Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Monkey
Product name | [KO Validated] CDK4 Rabbit mAb |
---|---|
Catalog No. | A11136 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51004 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). |
---|---|
Sequence | FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Gene ID | |
Swiss Prot | |
Synonyms | CMM3; PSK-J3; K4 |
Calculated MW | 34kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse, Rat, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, COS-7, Mouse lung, Rat lung |
Cellular location | Cytoplasm, Membrane, Nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus, Sus scrofa) IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11136? Please let us know so that we can cite the reference in this datasheet.