Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] CDK4 Rabbit pAb |
---|---|
Catalog No. | A16813 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). |
---|---|
Sequence | FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Gene ID | |
Swiss Prot | |
Synonyms | CMM3; PSK-J3; K4 |
Calculated MW | 34kDa |
Observed MW | 30kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, MCF7, COS-7 |
Cellular location | Cytoplasm, Membrane, Nucleus |
Customer validation | WB(Rattus norvegicus, Homo sapiens) RT-PCR(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16813? Please let us know so that we can cite the reference in this datasheet.