제품 > 항체 > 단일클론항체(mAb)

IL8 Rabbit mAb (A24736)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from THP-1 cells using IL8 Rabbit mAb (A24736) at 1:1000 dilution. THP-1 cells were treated by PMA/TPA (80 nM) at 37℃ for overnight and LPS (1 μg/ml) at 37℃ for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of Recombinant Human IL-8/CXCL8/GCP-1 Protein (RP00052), using IL8 Rabbit mAb (A24736) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5ng/1ng/0.1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - IL8 Rabbit mAb (A24736)

Confocal imaging of 293T cells transfected with IL8 using IL8 Rabbit mAb (A24736, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Flow CytoMetry - IL8 Rabbit mAb (A24736)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were intracellularly-stained with IL8 Rabbit mAb (A24736, 2 ug/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line), followed by FITC conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or IL8 Rabbit mAb (A24736 , 2 ug/mL, right).

Overview

Product name	IL8 Rabbit mAb
Catalog No.	A24736
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63866

Background

The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-99 of human IL8(NP_000575.1).
Sequence	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Gene ID
Swiss Prot
Synonyms	IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:200 - 1:400 FC (intra) 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	THP-1 treated by TPA and LPS, Recombinant Human IL-8 Protein
Cellular location	Secreted.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IL8 Rabbit mAb images

Western blot - IL8 Rabbit mAb (A24736)

Immunofluorescence - IL8 Rabbit mAb (A24736)

Flow CytoMetry - IL8 Rabbit mAb (A24736)

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or IL8 Rabbit mAb (A24736 , 2 ug/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.