Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | APC Rabbit mAb |
---|---|
Catalog No. | A17912 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0346 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APC (NP_000029.2). |
---|---|
Sequence | MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSRE |
Gene ID | |
Swiss Prot | |
Synonyms | GS; DP2; DP3; BTPS2; DESMD; DP2.5; PPP1R46; APC |
Calculated MW | 312kDa |
Observed MW | 160kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | SW480, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell junction, Cell membrane, Cell projection, Cytoplasm, adherens junction, cytoskeleton, lamellipodium, ruffle membrane. |
Customer validation | WB(mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17912? Please let us know so that we can cite the reference in this datasheet.