제품 > 항체 > 단일클론항체(mAb)

c-Fos Rabbit mAb (A24619)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with c-Fos using c-Fos Rabbit mAb (A24619) at 1:7000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.3s.

Overview

Product name	c-Fos Rabbit mAb
Catalog No.	A24619
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63308

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 211-281 of human c-Fos(NP_005243.1).
Sequence	GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPS
Gene ID
Swiss Prot
Synonyms	p55; AP-1; C-FOS; c-Fos
Calculated MW	41kDa
Observed MW	40-62kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:7000 - 1:42000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293F transfected with c-Fos(Human)
Cellular location	Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol.
Customer validation	WB(Mus musculus) IF(Rattus norvegicus)