제품 > 항체 > 단일클론항체(mAb)

c-Fos Rabbit mAb (A24620)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from NIH/3T3 cells using c-Fos Rabbit mAb (A24620) at 1:1000 dilution incubated overnight at 4℃. NIH/3T3 cells were treated by PMA(200 nM) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Western blot analysis of lysates from PC-12 cells using c-Fos Rabbit mAb (A24620) at 1:1000 dilution incubated overnight at 4℃. PC-12 cells were treated by PMA(200 nM) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - c-Fos Rabbit mAb (A24620)

Immunohistochemistry analysis of paraffin-embedded Human cervix using c-Fos Rabbit mAb (A24620) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using c-Fos Rabbit mAb (A24620) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	c-Fos Rabbit mAb
Catalog No.	A24620
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63309

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 211-281 of human c-Fos(NP_005243.1).
Sequence	GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPS
Gene ID
Swiss Prot
Synonyms	p55; AP-1; C-FOS; c-Fos
Calculated MW	41kDa
Observed MW	62kDa//62kDa/62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	PC-12, , NIH/3T3, PC-12, NIH/3T3
Cellular location	Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol.
Customer validation	IF(Canis familiaris)