제품 > 항체 > 단일클론항체(mAb)

NQO1 Rabbit mAb (A23486)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using NQO1 Rabbit mAb (A23486) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - NQO1 Rabbit mAb (A23486)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using [KD Validated] NQO1 Rabbit mAb (A23486) at dilution of 100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.0) prior to IHC staining.

ABclonal:Immunoprecipitation - NQO1 Rabbit mAb (A23486)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg NQO1 antibody (A23486). Western blot was performed from the immunoprecipitate using NQO1 antibody (A23486) at a dilution of 1:1000.

Overview

Product name	NQO1 Rabbit mAb
Catalog No.	A23486
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0065

Background

This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NQO1 (NP_000894.1).
Sequence	MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF
Gene ID
Swiss Prot
Synonyms	DTD; QR1; DHQU; DIA4; NMOR1; NMORI; NQO1
Calculated MW	31kDa
Observed MW	31kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	NIH/3T3, Mouse liver, Mouse brain
Cellular location	Cytoplasm.
Customer validation	WB(Mus musculus) IHC(Mus musculus,Rattus norvegicus) WB(Mus musculus,Rattus norvegicus)