제품 > 항체 > 단일클론항체(mAb)

BMP4 Rabbit mAb (A11405)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using BMP4 Rabbit mAb (A11405) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - BMP4 Rabbit mAb (A11405)

Immunohistochemistry analysis of paraffin-embedded Human colon using BMP4 Rabbit mAb (A11405) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - BMP4 Rabbit mAb (A11405)

Confocal imaging of HeLa cells using BMP4 Rabbit mAb (A11405, dilution 1:50)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	BMP4 Rabbit mAb
Catalog No.	A11405
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0587

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 309-408 of human BMP4 (P12644).
Sequence	RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Gene ID
Swiss Prot
Synonyms	ZYME; BMP2B; OFC11; BMP2B1; MCOPS6; BMP4
Calculated MW	47kDa
Observed MW	47kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IF/ICC 1:50 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, A-549, PC-3
Cellular location	Secreted, extracellular matrix, extracellular space.
Customer validation	WB(Homo sapiens, Mus musculus)