Reviews (2)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NeuN Rabbit mAb |
---|---|
Catalog No. | A19086 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0202 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3). |
---|---|
Sequence | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR |
Gene ID | |
Swiss Prot | |
Synonyms | FOX3; NEUN; FOX-3; HRNBP3; NeuN |
Calculated MW | 34kDa |
Observed MW | 46-55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (Mouse brain) IF(Rattus norvegicus, Homo sapiens, Mus musculus) IHC(Rattus norvegicus) Cell culture(Rattus norvegicus) WB(Rattus norvegicus, Mus musculus) RT-qPCR(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19086? Please let us know so that we can cite the reference in this datasheet.