Reviews (2)Publications (12) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
The multiplex IHC analysis on paraffin-embedded Mouse brain tissue using the following specific primary antibodies and tyramide signal amplification (TSA) reagents (RK05903) : NeuN Rabbit mAb (A19086, 1:2000) with TSA-TYR-520 (Green), GFAP Rabbit mAb (A19058, 1:500) with TSA-TYR-570 (Red), and TMEM119 Rabbit mAb (A27143, 1:600) with TSA-TYR-690 (Yellow). DAPI (Blue) was used for nuclear staining. Prior to multiplex IHC staining, high-pressure antigen retrieval was performed using 0.01M citrate buffer at pH 6.0. The analysis was completed using a 20x objective lens.
The multiplex IHC analysis on paraffin-embedded Rat brain tissue using the following specific primary antibodies and tyramide signal amplification (TSA) reagents (RK05903) : NeuN Rabbit mAb (A19086, 1:2000) with TSA-TYR-520 (Green), GFAP Rabbit mAb (A19058, 1:500) with TSA-TYR-570 (Red), and TMEM119 Rabbit mAb (A27143, 1:600) with TSA-TYR-690 (Yellow). DAPI (Blue) was used for nuclear staining. Prior to multiplex IHC staining, high-pressure antigen retrieval was performed using 0.01M citrate buffer at pH 6.0. The analysis was completed using a 20x objective lens.
Western blot analysis of various lysates using NeuN Rabbit mAb (A19086) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using NeuN Rabbit mAb (A19086) at a dilution of 1：2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using NeuN Rabbit mAb (A19086) at a dilution of 1：2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using NeuN Rabbit mAb (A19086) at a dilution of 1：2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded human brain tissue using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded mouse brain tissue using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded rat brain tissue using NeuN Rabbit mAb (A19086, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
| Product name | NeuN Rabbit mAb |
|---|---|
| Catalog No. | A19086 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0202 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3). |
|---|---|
| Sequence | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FOX3; NEUN; FOX-3; HRNBP3; NeuN |
| Calculated MW | 34kDa |
| Observed MW | 46-55kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse brain, Rat brain |
| Cellular location | Cytoplasm, Nucleus. |
| Customer validation | (Mouse brain) IF(Rattus norvegicus, Homo sapiens, Mus musculus) IHC(Rattus norvegicus, Mus musculus) Cell culture(Rattus norvegicus) WB(Rattus norvegicus, Mus musculus) RT-qPCR(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19086? Please let us know so that we can cite the reference in this datasheet.
