Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BMP4 Rabbit pAb |
---|---|
Catalog No. | A11315 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2). |
---|---|
Sequence | QHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN |
Gene ID | |
Swiss Prot | |
Synonyms | ZYME; BMP2B; OFC11; BMP2B1; MCOPS6; BMP4 |
Calculated MW | 47kDa |
Observed MW | 47kDa/23kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | A-549, Mouse lung, Mouse kidney, Rat lung, Rat kidney |
Cellular location | Secreted, extracellular matrix, extracellular space |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11315? Please let us know so that we can cite the reference in this datasheet.