제품 > 항체 > 다중클론항체(pAb)

eIF5A Rabbit pAb (A2016)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using eIF5A Rabbit pAb (A2016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - eIF5A Rabbit pAb (A2016)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using eIF5A Rabbit pAb (A2016) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - eIF5A Rabbit pAb (A2016)

Immunofluorescence analysis of U2OS cells using eIF5A Rabbit pAb (A2016). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	eIF5A Rabbit pAb
Catalog No.	A2016
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human eIF5A (NP_001137234.1).
Sequence	MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Gene ID
Swiss Prot
Synonyms	FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI; eIF5A
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, Raji, 22Rv1, HepG2, K-562, U-251MG, Mouse liver, Mouse testis
Cellular location	Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, nuclear pore complex
Customer validation	WB(Microplitis bicoloratus bracovirus, Trichoplusia ni)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달번역 제어eIF2 조절

eIF5A Rabbit pAb images

Western blot - eIF5A Rabbit pAb (A2016)

Immunohistochemistry - eIF5A Rabbit pAb (A2016)

Immunofluorescence - eIF5A Rabbit pAb (A2016)

Immunofluorescence analysis of U2OS cells using eIF5A Rabbit pAb (A2016). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.