제품 > 항체 > 단일클론항체(mAb)

eIF5A Rabbit mAb (A4414)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using eIF5A Rabbit mAb (A4414) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	eIF5A Rabbit mAb
Catalog No.	A4414
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0999

Background

Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241).
Sequence	MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLS
Gene ID
Swiss Prot
Synonyms	FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI
Calculated MW	17kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Jurkat, HUVEC, Mouse testis, Mouse pancreas, Rat lung, Rat testis, Rat spleen
Cellular location	Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, Nuclear pore complex