Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Fas Rabbit mAb |
---|---|
Catalog No. | A19582 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0061 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fas (NP_000034.1). |
---|---|
Sequence | EGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE |
Gene ID | |
Swiss Prot | |
Synonyms | APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6; Fas |
Calculated MW | 38kDa |
Observed MW | 48kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Jurkat, HepG2 |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein. |
Customer validation | IHC(Homo sapiens) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19582? Please let us know so that we can cite the reference in this datasheet.