Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Sarm1 Mouse mAb |
---|---|
Catalog No. | A23440 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG1 |
CloneNo. | AMC0559 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Sarm1 (NP_766383.2). |
---|---|
Sequence | MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVE |
Gene ID | |
Swiss Prot | |
Synonyms | Sarm; MyD885; A830091I15Rik; Sarm1 |
Calculated MW | 79kDa |
Observed MW | 72kDa/80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji, Mouse brain, Rat brain |
Cellular location |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.