Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | cGAS Mouse mAb |
---|---|
Catalog No. | A27100 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG2a κ |
CloneNo. | AMC0693 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human cGAS (Q8N884). |
---|---|
Sequence | MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAP |
Gene ID | |
Swiss Prot | |
Synonyms | MB21D1; h-cGAS; C6orf150 |
Calculated MW | 59kDa |
Observed MW | 63kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 4℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.1% Sodium azide, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | RT4, RAW 264.7 |
Cellular location | Cytoplasm, cytosol. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.