Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | VHL Mouse mAb |
---|---|
Catalog No. | A21083 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG2b, Kappa |
CloneNo. | AMC0442 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of VHL(NP_000542.1) |
---|---|
Sequence | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLP |
Gene ID | |
Swiss Prot | |
Synonyms | RCA1; VHL1; pVHL; HRCA1; VHL |
Calculated MW | 24kDa |
Observed MW | 18kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, Raji, 293T, Mouse embryo, Rat testis |
Cellular location | Cytoplasm, Membrane, Nucleus, Nucleus, Peripheral membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.